PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513973.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 194aa    MW: 22546.8 Da    PI: 8.044
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513973.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.83.7e-153271847
                    HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    + q +f+kR++g++ K  ELSvLC+a+ a+ii s++ k+y
  XP_004513973.1 32 KDQLSFAKRKQGLFNKVTELSVLCQAKTALIITSKDKKIY 71
                    4589********************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-101676IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.7551777IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-81939IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-161987IPR002100Transcription factor, MADS-box
PfamPF003199.1E-133271IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-83954IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-85475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAFIERNNLA TKPNISRKRK FENIKVEEKF NKDQLSFAKR KQGLFNKVTE LSVLCQAKTA  60
LIITSKDKKI YACGYPNVDT VIRHFLDGQQ NPVDGEKQMM QEEEESVENL RVQYEALQDQ  120
LKEEKKNLQV ITEAQKNGSC FHSWWNDSID DMNLESLEMF KTSLENLKLN LLLSLDEKRI  180
RSSSSTIRNQ IIGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513973.11e-141PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLG7L9555e-59G7L955_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA07G05061.16e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132271027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-21AGAMOUS-like 62